PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.5N08M
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 741aa    MW: 80727.4 Da    PI: 5.582
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.5N08MgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.6e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
      Aradu.5N08M 24 RERWTEEEHNRFLEALKLHGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-161874IPR009057Homeodomain-like
PROSITE profilePS5129420.2261973IPR017930Myb domain
TIGRFAMsTIGR015579.5E-162271IPR006447Myb domain, plants
SMARTSM007171.3E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-82364IPR009057Homeodomain-like
PfamPF002491.8E-132467IPR001005SANT/Myb domain
CDDcd001671.43E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
MDAYSSGEEV VIKTRKPYTI TKQRERWTEE EHNRFLEALK LHGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAQAKG VPIGQALDIE IPPPRPKRKP SNPYPRKTSA GAASLHSGAK  120
DGKLSSLESS HAKQALDLEK EPVPEKHNGD KVSHVKENKD ENCSKVFALL QELPCSSVSS  180
ANKSSISWSV PLQNSCGLRE IIPSVKEVIA KDGTNKSFVT IELENRKLEI DDGKQTNGNS  240
SLENSDTVKL VQNEKTDGLN CELTIDGIQG NQNYPRHVTV HVVDGKLGTS TANPSQDMVF  300
QDSMFQPLGG INGQPNLFTN STASNTSESQ NNTERSSVHQ SFLPYPPFIQ NNQGDYQSFL  360
QMSSTFSSLI VSTLLQNPAA HAAASFAATF WPCANSEASA DSPTCSQGGF PPRQNGSPPS  420
VAAIAAATVA AATAWWAAHG LLPLCAPLHT AFACPPTSMP AVPSINTEQE KNSLQNPPQQ  480
DQTLDPVCSE AQQAQQSPSK SPVDISSDSE ESGDAKLHAS PSKATDQELN KEISEHIDSN  540
KAKGRKPVDR SSCGSNTTSS SELETDALEK DEQGKEEPET ADANNLAIDS SNRRSRSVSN  600
LTDSWKEVSE EGRLAFQALF AREVLPQSFS PPPDLLNKDQ EMDSIKDNKQ TTDIKDEGQD  660
SKKCSSIFEG IQKMMPCIEN NEEEGLLTIG LGQGKLKTRR TGFKPYKRCS MEAKENRVGS  720
TGNQGEEQGS KRIRLEGEAS T
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015948118.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948119.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948120.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948121.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948122.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948123.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948124.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948125.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948126.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948127.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_015948128.10.0PREDICTED: protein LHY-like isoform X1
TrEMBLK7KZP50.0K7KZP5_SOYBN; Uncharacterized protein
STRINGGLYMA07G05410.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.12e-83circadian clock associated 1